NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208029_1007032

Scaffold Ga0208029_1007032


Overview

Basic Information
Taxon OID3300025264 Open in IMG/M
Scaffold IDGa0208029_1007032 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3408
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)39.48Long. (o)6.37Alt. (m)Depth (m)2851
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001651Metagenome / Metatranscriptome657Y
F005219Metagenome / Metatranscriptome408Y

Sequences

Protein IDFamilyRBSSequence
Ga0208029_10070321F005219GGAGGMKIIKRTCLECGGSMTAELLRPDPHQPPEFLLICPCGHSEPASPDIEAELEDRPRMPGF
Ga0208029_10070324F001651GAGVALNNGKALAAENRRSQVLQMKMAGATEQAIAEQVGVSKTQVHNDIHRRLAEVRRDDKEAVQLEYNLQRARYERLLLRWWSQAIGPADDQSARATGIVLDILRRLDTIGGLIPEKPLIQLQQQNLIVGGVTFADLLREAMDGAGQVVEGERVDLGTDLAL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.