NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208813_1056017

Scaffold Ga0208813_1056017


Overview

Basic Information
Taxon OID3300025270 Open in IMG/M
Scaffold IDGa0208813_1056017 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)859
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)43.49Long. (o)7.9Alt. (m)Depth (m)2455
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000730Metagenome / Metatranscriptome917Y
F032307Metagenome / Metatranscriptome180N
F036732Metagenome169N

Sequences

Protein IDFamilyRBSSequence
Ga0208813_10560171F032307AGGLVVQKLLLQEGLKRTKQYSVSVLGYDFIGLAMRLGLFLAVGVLIQAYFTATITGGSWLNSIAGFFNIKFPDTLPEWLTKLFTTGYNGIAFWQILQITAILLVIVEYMQYDRMLK
Ga0208813_10560172F000730GAGLVSELIPPEIIPIVWFGCISVTIYVFFRVFSSTLREKFKQTNLSRRQAEKGGNTDGQIDDLISNAPRILHEIDKQIAEQKAQGVSDEQMKGLYQKKQLLSLVADNQEVINIIGKPIIKKLLGFVKAI
Ga0208813_10560173F036732N/APVAPLLKTAVMKAFYESGISLHLHPDLSHADGVFKYKKDRVSLLGQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.