NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208030_1068211

Scaffold Ga0208030_1068211


Overview

Basic Information
Taxon OID3300025282 Open in IMG/M
Scaffold IDGa0208030_1068211 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)960
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)38.38Long. (o)4.65Alt. (m)Depth (m)2720
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000704Metagenome928Y
F064236Metagenome / Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
Ga0208030_10682111F064236N/ASMPYRIAVQPTATGLGAAANAITGGGGIMQYNMPRGKGIPLANNVTITNYYTNRDARAGGASNFINFVRYSKN
Ga0208030_10682112F000704AGGTGGMPHENGEILPSNVKAVATYDIGSYGEDLFLPLTDVGLTETALTFSTATVTRDTTDSNQPIDTYPRVFSDTDSGLLLNEGNDTAYDQTYTLDPDMTAIIYKISLNFCAVLTCSAYTNGGLNIGGLHIKITERSTNDRLLYENTFQSGAATLGATGTSMHWFTQDIVETIKVNKGNPIDIQLNLVTVVTGTNTRQEGYAPVAPLLKTAVMKPFFESGISLHLHPDLSHADGVFKYSKQRVSLLG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.