NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208048_1008375

Scaffold Ga0208048_1008375


Overview

Basic Information
Taxon OID3300025283 Open in IMG/M
Scaffold IDGa0208048_1008375 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3925
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameMalawi: Central Region
CoordinatesLat. (o)-13.5167Long. (o)34.7703Alt. (m)Depth (m)45
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006543Metagenome / Metatranscriptome370Y
F074795Metagenome119Y
F088817Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0208048_10083751F074795GGAGVTKEQAILKILKVLKNAMLVVNKHNRDEALTLATEHGITAKELIEVWADLAMRV
Ga0208048_10083754F088817AGGAGMNGYELIAELEKCVREIVTVPNSWLPEEFRDNRTDCVSLADLETKCDSMERGETDHEEEKREKARRIELYRSMIDKNEEITYLMKGT
Ga0208048_10083758F006543GGAGMQKFTFNVDVVATDLDRESVAESIRECLSDALPGDVHASVKAGEVKAFSEQGYKVWRARVTGVTAEAAGDAANPKKAKETVEA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.