NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210044_10290169

Scaffold Ga0210044_10290169


Overview

Basic Information
Taxon OID3300025288 Open in IMG/M
Scaffold IDGa0210044_10290169 Open in IMG/M
Source Dataset NameGroundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)881
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)38.9383Long. (o)-110.1342Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012423Metagenome / Metatranscriptome280Y
F076874Metagenome117N

Sequences

Protein IDFamilyRBSSequence
Ga0210044_102901691F076874N/AGRLEVSKTALGGEGARIRVRNAKRLSGEDIVQTSDGIYSTFIVSSDETVQKVDIVFQIKKKHNISLNVTWR
Ga0210044_102901692F012423N/AMVASKYNGDNCVINIGVSNEADSTAQDYGLSICLKDEDGDEYTLAMVGVIGMFLTGVFRKITDTDKIIKNKFYFDKGRTYNYNITAPFPDMKEGKVYGQLGVYDGIDEDSVRKAETTYDYVYNFEKKKFSMSVSVEWK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.