NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208934_1035757

Scaffold Ga0208934_1035757


Overview

Basic Information
Taxon OID3300025293 Open in IMG/M
Scaffold IDGa0208934_1035757 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)947
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)39.48Long. (o)4.36Alt. (m)Depth (m)1304
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007750Metagenome345Y
F021299Metagenome / Metatranscriptome219N

Sequences

Protein IDFamilyRBSSequence
Ga0208934_10357571F021299N/ALNSVKGLDWDTIACLTGDIGTIKKSIQTLNNRINGLNSPKLNDELLHYAIKQQNGAMNPPTDKLGG
Ga0208934_10357572F007750AGGAGGLAFLGDFGKFFGLGSSKQVLGDVGGTVGSLVGLEGAGRRAGEFIGSTTSSIGSGSNVNISPLSTADQALEQSAVPVSQIGSPRPSEISQLGTTGMVNQAGFGSLAPLITGVGRFLGSKTGQIATGVGTATAFGGSQLLGMNGKERPVLTQSRRNKAKVRQLVNFMGIEGTANFLSQSIGQNVSPNDVVMLLLRTFRNDGAFITKAQVRNLRRTTNRFKSLEKQVKDATSMTRTTRRAPVRRASSTTLI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.