Scaffold Ga0209211_10024842

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209211_10024842

Scaffold Ga0209211_10024842

Overview

Basic Information
Taxon OID	3300025308 Open in IMG/M
Scaffold ID	Ga0209211_10024842 Open in IMG/M
Source Dataset Name	Soil microbial communities from Rifle, Colorado, USA - Groundwater A2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6505
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (87.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatitalea → Desulfatitalea tepidiphila	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location Name	Rifle, Colorado, United States
Coordinates	Lat. (^o)	39.53	Long. (^o)	-107.78	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056711	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209211_100248426	F056711	AGGA	MLAAAAFALAILAGGCAKDKSPPRLQPAKKGIAGAEKKAAPKPRAKLFTGTIEDLDEAAGTLTLKGPKGEMSFQAREKVKEQLGELELGDKVIVKHDGKTALSIVKPRTSKTALALYRNEEPGKSHPNFSNQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.