 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300025313 Open in IMG/M |
| Scaffold ID | Ga0209431_10700245 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 748 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rifle, Colorado, United States | |||||||
| Coordinates | Lat. (o) | 39.534762 | Long. (o) | -107.782602 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053187 | Metagenome / Metatranscriptome | 141 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209431_107002451 | F053187 | N/A | THHFQKVVAVAPTASGEPSADITLQDPTLTDVTSALTMFRIGTFIGDMAQRQAAVNLAEVVGIAHGNGINRDMNNDIYVTLNANTTNTRTVGAGADAKTTNYAWSDIFGIRGQIEKNRGRPDTFVTFPQLPAVSTGVEVGWYPFVVSNITAVQYTAALADYLRTGSIAEVFGLRLFVDNIYTIAKNMSAAGDELAHCLVSNEATGWAQAEDIVSEVQRWALQVGFRIVTHSIGDSANVLEEYIGSIQHA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |