NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207697_10000178

Scaffold Ga0207697_10000178


Overview

Basic Information
Taxon OID3300025315 Open in IMG/M
Scaffold IDGa0207697_10000178 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)32657
Total Scaffold Genes35 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (28.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameKellogg Biological Station, Michigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000283Metagenome / Metatranscriptome1379Y
F000336Metagenome / Metatranscriptome1274Y
F007617Metagenome / Metatranscriptome348Y

Sequences

Protein IDFamilyRBSSequence
Ga0207697_1000017817F007617N/AMKHYLVLFFFFITASICHATSNITFSGGGYEISVLLSDEDCKVVGLNVSGDNGSILSIETNDLAAFSKAESDCKKKTIHLVVPATESQPYFELKSTSKKGHLTLGEKKVKVSPDWEM
Ga0207697_1000017824F000336N/AMPSGGKKKRKKPSRKKSDIDSALDQIGDESVAAATAEFQDLVSEAKGDTTELIRQNAEEVERRLDLLKKREIDKEDFDHFVENQKRDLRVFIDAQPAQAQERAEKLTLHILETAAKVAIALI
Ga0207697_1000017825F000283AGGAMNSTLVSRNVFLCAAAIFIASCGTATFTKSGSDATIESLRSFHLAFIDEFAVPGKKFNATAFNAKVNEGNAKFQQAIANDKFTARRPVFVDLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.