Scaffold Ga0209670_103598

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209670_103598

Scaffold Ga0209670_103598

Overview

Basic Information
Taxon OID	3300025349 Open in IMG/M
Scaffold ID	Ga0209670_103598 Open in IMG/M
Source Dataset Name	Thermal spring microbial communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter B (PS_B) MetaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4209
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.376	Long. (^o)	-110.69	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051572	Metagenome / Metatranscriptome	144	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209670_1035983	F051572	GAG	MTSRTHSGPFAEVRTFADVVLEGGCKKSLQFLNTHFDLCVLTVLIKTAPAGPMVKLRPEMVRRLVEEVAAAVGGGDRERIRNAMLKRAGEMMAQLRRELGDSAPSEAYVAKLAELFLKKLEA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.