NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208738_1019112

Scaffold Ga0208738_1019112


Overview

Basic Information
Taxon OID3300025379 Open in IMG/M
Scaffold IDGa0208738_1019112 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1103
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aurantimonas → Aurantimonas manganoxydans → Aurantimonas manganoxydans SI85-9A1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035192Metagenome / Metatranscriptome172Y
F048089Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0208738_10191124F035192AGGAGMSTPKETLDKAYGNMPKEVGFNFDISFMPTWRGIKYYWHKLIRKVTR
Ga0208738_10191126F048089AGGMLKPGKTFKLSKTAKRMIALMKGSTAEQRNQYKRMMIDAQLCSEIVVKTPTRDKNAPRGTSNYQVTDTSAVTLD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.