NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209120_1011862

Scaffold Ga0209120_1011862


Overview

Basic Information
Taxon OID3300025462 Open in IMG/M
Scaffold IDGa0209120_1011862 Open in IMG/M
Source Dataset NameHot spring microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC2_E (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1894
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameJoseph's Coat, Yellowstone National Park, Washington, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070317Metagenome / Metatranscriptome123Y
F077499Metagenome / Metatranscriptome117Y
F077502Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
Ga0209120_10118621F070317GGTGGMQTTVNNMSTMEELKELNLERIVKDAQEGEVCVVNKILKGKLTDLMPLIRDPANLSQKAMEFIQSRGDDVFYLFQCTIRQGRNVKLLVRQSFDPRSTFYSLMKKYKTIKVGDEVNVFYNPEKRRYDFLL
Ga0209120_10118622F077502N/AMTDVAHIVIWIEKNLPEEGKLSELIDNVFSLIQEIILNNLSQGKQPISFTSVREIADTFRELIYRSIEQSVGTLTEKVKEQVDTYFFKKLNDIYDKYYS
Ga0209120_10118624F077499AGGMTDLFVFPHESLKPVSYPNITNAEIVFILTITVPIGEHPNADSPMDEKMRFLSTYMPLEFQKMQYMKAIDRALDILKYSLYSREENVLFEIANKINSMYDIKQLTNKVKDVECTKDLKQINVILTEAKRYIYPDISLSKHASAQAKQLGIKKYEYYSRIFQCYIEQDRDLDMLTLFRVSNIVYNYIRLNNLSNIMKKMKF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.