NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208193_1038864

Scaffold Ga0208193_1038864


Overview

Basic Information
Taxon OID3300025463 Open in IMG/M
Scaffold IDGa0208193_1038864 Open in IMG/M
Source Dataset NamePeatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1111
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001473Metagenome / Metatranscriptome688Y
F002408Metagenome / Metatranscriptome562Y
F072572Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0208193_10388641F072572AGGAGMASSATKMANEPEGAGEERQPDVQLQDVLFSALASSVCYWTTIFLLAIVGAYLIQWWLTHPGPYPAPANDP
Ga0208193_10388642F001473GGAGMESEYQTVGQMYERLRLMIRQRNDTGFRLAVTDAVLEPRNPFEPASKRRPKSVVSVTLILVLVLALIFLYFSLHHAT
Ga0208193_10388643F002408N/AYELVPAVSDAAQMDFAIDYRQPQPQAQVTKPKPPEPVAVVSTVPSEMLLSSTPVRLVGGAAAPKANLGVLIRDVYRRQDEVFVRYSIENHSTQTLRAGAPAVVSLTGLKFDRSLWTFQNAQLGIEYESRLKTYDAPIPVKIRQCDPGVAEVGPGGTRIGLIALQLPAVNPDAKKTQPTVLKILFPIDRSGNLTATLVL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.