NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208389_1006446

Scaffold Ga0208389_1006446


Overview

Basic Information
Taxon OID3300025470 Open in IMG/M
Scaffold IDGa0208389_1006446 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3379
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (11.11%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045530Metagenome / Metatranscriptome152Y
F061527Metagenome / Metatranscriptome131N
F086589Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0208389_10064461F086589N/AMEATLITLDTLLSNMEAELRTDMNINIPSNQEFEPSQQGDGDEIFLSANTDIRHSLNEIGQNSQKGDGDEIFLSANTDIRHSLNEISQNSQN
Ga0208389_10064462F045530N/AMTKSITEKLEFLNSMEEFYQKVQEMLHYLGIKSPSKPDFNYYSELIKQRKQDLAFARWTIQRQYRKWFMVHMSKTGLIKIYKSKEQIKKVYNTAITEEETHRYVDEEGPPKKRFSGIYTRQKIQLN
Ga0208389_10064465F061527N/AMSNYFEQAFSEILSAIKELTIKIGTAIRIEQQKVPADPSIRTVHYYHMIIRNKIDQLSSRVAIMSFKTDQYCLLKVYGTLLIMVNRALNESNLKSKYVQLKLLHRMLEDFENNSTFSYWKDHVILGDRAVRETDG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.