NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208478_1000088

Scaffold Ga0208478_1000088


Overview

Basic Information
Taxon OID3300025475 Open in IMG/M
Scaffold IDGa0208478_1000088 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)35592
Total Scaffold Genes40 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)32 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow Environmental Observatory site, Barrow, Alaska
CoordinatesLat. (o)71.2999Long. (o)-156.61Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011239Metagenome / Metatranscriptome293Y

Sequences

Protein IDFamilyRBSSequence
Ga0208478_10000882F011239GAGGMIEAETLKSIAKQLMTGTSVSVGGISTPVRRTSRQHLKTAAFSVEGQEYEAIEQNPEKPSRWGHLARSGHQVVQFKDAESNKFVAVVVDGEVTFYGASKKRS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.