NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209557_1009461

Scaffold Ga0209557_1009461


Overview

Basic Information
Taxon OID3300025483 Open in IMG/M
Scaffold IDGa0209557_1009461 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3796
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030435Metagenome / Metatranscriptome185Y
F033796Metagenome / Metatranscriptome176N
F053299Metagenome / Metatranscriptome141N

Sequences

Protein IDFamilyRBSSequence
Ga0209557_100946110F053299AGGAGMNNYKPYYRTDKMKQEELRIAKYVSILFFTMVAFSFIGFSFVLVKAMLYMTGLFL
Ga0209557_100946111F030435N/AMNNKDILDMCRRLASKYYNHQDYDDIVSEGVVLCLNMRAEGIKEPSKLYYSARTAMFQYVNVGMSQLSYPKGMAGREAVMEDRSVYLSADEAQIPAEDIFGSYELKDSIEVLKKELSPKEWRLFMVLYNNNNNLTEASKVLNVSRQAVEQIRNNIRYKLVTICDLAI
Ga0209557_10094615F033796AGGMAENKTYKVAGVHIGKKGVTVLDGNKRVLEEAEQSAKLLTGKYALENSLGITNFVAFNTHALTMLPPYSIDMEAEWNYVVEQEGDTPSVEINRQAEGSI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.