NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209012_1002214

Scaffold Ga0209012_1002214


Overview

Basic Information
Taxon OID3300025503 Open in IMG/M
Scaffold IDGa0209012_1002214 Open in IMG/M
Source Dataset NameFerric oxide microbial mat and aquatic microbial communities from Rainbow Spring, Yellowstone National Park, USA - RS3B (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17555
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (56.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008949Metagenome / Metatranscriptome325Y
F021133Metagenome / Metatranscriptome220N
F023140Metagenome / Metatranscriptome211Y
F076262Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0209012_10022143F021133N/AMGRRDELIRQIYENGNYAIKKICEMNPDDKMANFSATDCIIGTANTHLALKIAKEKGYPPDVIEYLENQSKQEQWHCQLHIGKPPKPYDFVVAQKHREILLKYGIYVWMGVMPLLGEKIALAKAICWRRNDDPHFVDKFATVDEYYHTTYPLLLLSKYAPEEELERIVELQKEYITNIFKLK
Ga0209012_10022144F023140GAGGMRDTPVGVETSPLGRGAVRVPIYIFLKSFPFFIIFGAGVLTTLSILILFFYFLDAKFVGTWAILQKLAVTLPTSFVLAHLVKLLPSNPLLDYIILFVVGYSISTPLIFLTYHITMLLYGKKR
Ga0209012_10022147F076262AGGTGGMSLNPVIKGSYTLAAPQSVSVAASSSSSVSISFTPLGAGELYVYIALPSGVTATISIGGQSVSLSNGGNQFLIPANVTIGNITINNSNTSAVSVVVWALFIEVA
Ga0209012_10022148F008949N/AMEGYTVRWMSSQTVQLGTQTITPKVQDLGSTYYIGFQVKITKYLNNSTNQTIDVKFNCNKYKQVVVPSDPLSPPTVQTVQKTIQECVDEWYNQHKSVYEVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.