Basic Information | |
---|---|
Taxon OID | 3300025539 Open in IMG/M |
Scaffold ID | Ga0210109_1069004 Open in IMG/M |
Source Dataset Name | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 567 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: San Francisco Bay, California | |||||||
Coordinates | Lat. (o) | 38.003361 | Long. (o) | -122.468277 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058118 | Metagenome | 135 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0210109_10690041 | F058118 | N/A | VTEKTSDKLKKIKLKDYLLAMAIKLYNLEVLVDDLVYVGSDIRAKSQEDAVRILGIISGGEVTEDSEVLSCEEKTLH |
⦗Top⦘ |