NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208546_1031085

Scaffold Ga0208546_1031085


Overview

Basic Information
Taxon OID3300025585 Open in IMG/M
Scaffold IDGa0208546_1031085 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1313
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008402Metagenome / Metatranscriptome334Y
F013514Metagenome / Metatranscriptome270Y
F016800Metagenome / Metatranscriptome244Y

Sequences

Protein IDFamilyRBSSequence
Ga0208546_10310852F008402N/AMEISTQTRIQQHEDYWYTVEDTHIDVGCPGCTISYWELPSGMSTIDKRIQHICMDKEEAFAIADAIYKLFKKN
Ga0208546_10310853F016800N/AMIDAFTDYPIPSYGDIEGEKAPIRKATILTYDRNKYCDVLVYQVDEDGDLRGTVVNFKQFYLYKNEARLDDGIPFTYEELKTLTWTKISSPHFI
Ga0208546_10310854F013514GAGGMSINLEELQKYLDDNNITFEEYMRANMITDEDRKYFDEIWVDAIYKNLGEDT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.