Scaffold Ga0209658_1055462

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209658_1055462

Scaffold Ga0209658_1055462

Overview

Basic Information
Taxon OID	3300025592 Open in IMG/M
Scaffold ID	Ga0209658_1055462 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1043
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	Saanich Inlet, British Columbia, Canada
Coordinates	Lat. (^o)	48.6	Long. (^o)	-123.5	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045800	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209658_10554622	F045800	AGGAGG	MLNRSPAEDCLEVKEYLDEMIEYYRYTSSPVLAERRKTYKDIKIALFGEDLDDGDTGTKSTRAWFY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.