NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208691_1066210

Scaffold Ga0208691_1066210


Overview

Basic Information
Taxon OID3300025612 Open in IMG/M
Scaffold IDGa0208691_1066210 Open in IMG/M
Source Dataset NamePeatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)816
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013912Metagenome / Metatranscriptome267Y
F066958Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0208691_10662101F066958AGGMELLLNISWLLLAVPGYWLWRRGADARLARRVTSLQFLLALGCVLVLLFPVISATDDLHAMRTEMEESATS
Ga0208691_10662102F013912N/ARLESGTLPPGIRLEEYGLLTGAAERAGEFQFVISVKDGSQPQQAVQKGFTIKVVEGLTLAWKTPARVTGNRIDGSVEVSNSTAEDMDLTFDVKAVADNGRATEIGYQHFTLKRGTQAMALPFGETLPFGGYVVYVNVVGEMLARNVIYRQQMQTPGALHVVVGP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.