Basic Information | |
---|---|
Taxon OID | 3300025613 Open in IMG/M |
Scaffold ID | Ga0208461_1002265 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 16000 |
Total Scaffold Genes | 15 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (73.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Japan | |||||||
Coordinates | Lat. (o) | 34.65 | Long. (o) | 135.05 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103516 | Metagenome / Metatranscriptome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208461_10022659 | F103516 | N/A | MKPVNGEIQSFLTPELQKSRCYNFLSAGREGEMIARKSNVLLNECNLSAKDAVDRVIYLTYTTRDAYVAESGENQVISKRVMGNKDIEIQSRLFYEKEGGVRGIQVLLNDFVDTNYVRGYEPGWAVRALYREVKMQDGKIAVVRDGMAREEFMKEDEIEHYRMLNLMLQEKK |
⦗Top⦘ |