NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208613_1004617

Scaffold Ga0208613_1004617


Overview

Basic Information
Taxon OID3300025616 Open in IMG/M
Scaffold IDGa0208613_1004617 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4217
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032141Metagenome180Y
F041596Metagenome / Metatranscriptome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0208613_10046175F041596AGGAMNKATPAPEANIWDDVPKETPKKETVRKTDKVVAKPAAVVTTVPQTPDYDLEGLQTDFPTATDLERFVFDETGVVLSLKGRANKMKYQVAMDVLNGQPVDPKFIGEGNPYLDKADMVPEEPMKELPPRPAEIPPLTEVQNEFFTAFVPHSDPEYHARGVRMHCTFRKYRNGCITYEVLGPIEPKPFGEKIDKFGRMRPEIIRWTDPRTGEQIVQREDGTLTPVGRRLKAMMQTMKYNDSNQWVRYIDRDFISLDQRAAANPWDLES
Ga0208613_10046176F032141N/AMQAKSINQKRGPTTGNENPGSKRADFMAEKSRTGSEKSELANMITGAVAARGRGMEGFRDKAVEGLHTNTNVGRGPTRGNAGRPQKSGGGRKGALGATSGY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.