NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209138_1003448

Scaffold Ga0209138_1003448


Overview

Basic Information
Taxon OID3300025617 Open in IMG/M
Scaffold IDGa0209138_1003448 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11338
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (94.74%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048209Metagenome / Metatranscriptome148Y
F069851Metagenome / Metatranscriptome123N
F075861Metagenome / Metatranscriptome118N
F088537Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0209138_100344815F075861GGAGGMFSLARNGERFGYCAKDKAGIEKYRGWYIDDHVVAEAAQIQLRLWNESKTSLLQSEAEQVARDTLEEQITIVEV
Ga0209138_100344816F069851GGAGMSLIDAIDANLEDLVDPKNRCVEATDAAANELVIAATEESPDELQELMFHESSNAVYAQFHVDMAKAFAGKMSHDDFFIKYEHYFDIAKRFIMDDLDSKIWNRYVDLHDVPVLDMHDYNGVRREDF
Ga0209138_100344819F048209AGGAMDNLSEKPCRCGDTMGEVIGFQERVTDGEMVKYRVCWYCPECHATEKAIGRETYIDTN
Ga0209138_10034489F088537AGGTGGMSTGPWEGGKGSRPRKYKVQKYLDNYDRIFGNASKQEEGQEGHQRKHQDRDGSGEASEAGDSHSYVKGEA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.