NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209405_1007854

Scaffold Ga0209405_1007854


Overview

Basic Information
Taxon OID3300025620 Open in IMG/M
Scaffold IDGa0209405_1007854 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5427
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030435Metagenome / Metatranscriptome185Y
F033796Metagenome / Metatranscriptome176N
F053299Metagenome / Metatranscriptome141N
F059965Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0209405_100785411F033796AGGMSSDENKTYKVAGINKGKGKGVTVLDGRKRVLEEAEQSAKLLTGKYALENSVGITNFVAFNTHALTMLPPYSIDMEAEWNYVVEQEGQEDTPSVEINRQAEGSI
Ga0209405_10078544F030435AGGMNNQEILDMCRRLASKYYNHQDYDDIVSEGVVLCLKMRAEGITDPPKLYYSARTAMFQYVNVGLSKLSYPKGMAGRDAAVNDTTVYVDPDEAQITADDLFGSYELKDSIEVLKKHLTPREWKVFLSLYNNNNNLTETSVETGISTRGLLDIRNRIRNKIVTFCDFVI
Ga0209405_10078545F053299GGAGMSKDYKPYYRTDKMKQEELRTAKYVSILFFTMVLFSFIGFAFVLVKSMLYMTGLFL
Ga0209405_10078548F059965GGAGMPIPPSMEMELMELGILKSDTEELESVAEQTGFYALRAETIAWHNTLIIDGEVMF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.