NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209204_1053834

Scaffold Ga0209204_1053834


Overview

Basic Information
Taxon OID3300025631 Open in IMG/M
Scaffold IDGa0209204_1053834 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1313
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan
CoordinatesLat. (o)36.29Long. (o)139.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022612Metagenome / Metatranscriptome213Y
F048731Metagenome / Metatranscriptome147Y
F103107Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0209204_10538341F103107GAGMVRVTKNRIVYWIDEKTGGYVELAGTKWDGNVSDEELMVRALQEAEEVGLDLSYGKILIEEEEVN
Ga0209204_10538342F022612AGGAGGMIRKILAYNNRYTRIRKDVARRLFKEGKTIYLTPSKVVASDSNMWIKPYPIDNQAGYDFDDIVNNYEYYNCCYELGYYTNFWITEVEE
Ga0209204_10538343F048731AGGAGGMVRTMEKALRYALAISEDPPRIKEHVEKYLAAAGFDRRYKFKWCAVSGNHRFTFSGIFEYAGQRYYFNRLNDLHLEKI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.