NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209136_1010284

Scaffold Ga0209136_1010284


Overview

Basic Information
Taxon OID3300025636 Open in IMG/M
Scaffold IDGa0209136_1010284 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4241
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001588Metagenome / Metatranscriptome667Y
F103423Metagenome / Metatranscriptome101N
F104071Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0209136_101028410F001588GAGGMQNTTNNVFLNAANAAIVVTVNNKVVATDVQTADALVQVFLTHNINVLTDTIMCSSSIDFAEEEGFASDASAHNIIDEAFEQLA
Ga0209136_10102842F104071AGGAGGMQNTQLNTQLNDVHFTDEQHKQLAALTQEWNTKCEGDYASTFVGGVAHGYCDSGIMTDGLSAADVAVLSKYFTGETIYSAAVAIDTLEQWVTQLEATEWCTDMYKFVAAVESVLTLEQQQDMNALEAAMSYCWDCCE
Ga0209136_10102843F103423GGAGMRFICTREQELTEGEYTEGVVVEAYGKYYWLLENGECMLTDASAADLNCADEFLADDVFRAISAADEKYKLDYSVDKVAEFAEDFYTAVREA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.