NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209136_1026335

Scaffold Ga0209136_1026335


Overview

Basic Information
Taxon OID3300025636 Open in IMG/M
Scaffold IDGa0209136_1026335 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2232
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022603Metagenome / Metatranscriptome213Y
F061370Metagenome / Metatranscriptome132Y
F077967Metagenome / Metatranscriptome117N
F085331Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
Ga0209136_10263352F085331AGGAGMTIHYSTTVQDYFVHLTNDCKDEARFTQDEKCFVLEFLADTLNALTQMNSECLRDEGNFARMQDCAEVADNYVMLLNKCTSEYDGEDAYTFTLEDAGAAICSYDTEYRECICEQFEDALNEYFALSKAGKIQKLDIANCLAWRVFNSY
Ga0209136_10263353F022603AGGAGMQVHVLQLQGTGDDEYAYENAAVCANYEDAIERLAEINADYAEYDSAFFKLDDNARIETHDLVDNNWGL
Ga0209136_10263355F061370AGGAGMQKYTEDYSKMTDEELVMTYNAVMANAYPGDECAIEDEMQKRELSADMDEMFAYPTPS
Ga0209136_10263358F077967AGGAGGMMDPKKSFWNEALDIIEGDNEVEQEHVSLDELYDEETATNHHVEGIDNW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.