NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208162_1019707

Scaffold Ga0208162_1019707


Overview

Basic Information
Taxon OID3300025674 Open in IMG/M
Scaffold IDGa0208162_1019707 Open in IMG/M
Source Dataset NameFreshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2621
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)38.9819Long. (o)-76.3716Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008883Metagenome / Metatranscriptome326Y
F024320Metagenome / Metatranscriptome206Y
F026889Metagenome / Metatranscriptome196N
F038216Metagenome / Metatranscriptome166Y

Sequences

Protein IDFamilyRBSSequence
Ga0208162_10197071F038216GAGMPPQRYTVMLKQVNYARTELIEGSHRTLSDAVTMYAIYYSDWSESLEALSQYYDTDEWKDSGYGEDLPRHRELVQRRNAALRNVHEIGDELRSLGLDVDLCEWATVDEHFEDAA
Ga0208162_10197073F026889GAGGMNNVIEEYLALVERTVYHSDLDAFDALEQLEEQYPELADLVYQSAGPLAYDIQNNEVIS
Ga0208162_10197074F008883GAGGMNFGRYTIWYNHEDHVWDIYDGNKGYKYPEYTINNYSGLMNKLRDRFGFLDTDRNHRRFWRVMRWWDRLRHGSTAYSRGRR
Ga0208162_10197078F024320AGGGGGMTFEEYEQGYYSGDSEDPSGPPEDPETHAMIEHLVEFDTEMYRLESRRKYKGLSYKHLETLMVELHGREWR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.