NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209719_1021525

Scaffold Ga0209719_1021525


Overview

Basic Information
Taxon OID3300025677 Open in IMG/M
Scaffold IDGa0209719_1021525 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2954
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan
CoordinatesLat. (o)43.77Long. (o)142.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064748Metagenome / Metatranscriptome128Y
F078879Metagenome / Metatranscriptome116N
F103501Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0209719_10215255F078879GAGMTPEVSNEVKEGYDILEGIGIVERTESGQYYPTDVGAAIIYAVLCKQMLGAGEDECESEESQQVMMNRLEEMDLVEQGDESFVITIEGFTTFFTNLTYGCPYREEFIDWLALATAALAEEME
Ga0209719_10215257F103501AGGAMVKSIILEGVVSYDNKYDLWCVDEDFIENIISDFEDKKVLVTITEI
Ga0209719_10215258F064748AGGMKKYRFIGNVEDVTPCGNMDADCIAAGCKGKVWGQCHFDPLLNLLSSGAEYFAEILNECEVIDTVFRVEKNGLYSSGGLNPLFVKNGKTWMKRGHVKNHFKQQSLYNCETHTPIYLYQEYPEDAEVVEYALVEVKRTPVRKFVEGDV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.