NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209306_1014184

Scaffold Ga0209306_1014184


Overview

Basic Information
Taxon OID3300025680 Open in IMG/M
Scaffold IDGa0209306_1014184 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2959
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049283Metagenome / Metatranscriptome147N
F072845Metagenome / Metatranscriptome121N
F090257Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0209306_10141843F049283N/AMKMYSFKVGKMKDVQKVVHSAYDIWAAAVCAQRINKGYYKEDEFNADGECVREANRTVARNALALGGKITVEDRCKGAEIRKFISSRLMVTAITRKLNDFQQSLSRAVELDEFVVPQDRMLIGIVNSQIAQYERAMREEQLTKDYVYGTYGKIKERLDVELKPVSRFWLTDWGTFRYNAITKDGYKTSFYYRDKLEIGDAVKVRGTVTKHTNDTTTINRIKVL
Ga0209306_10141846F090257AGGMFKKKEDLDQLFGDNESISALVVAICATMFDNGVRIIPIGGLMRLLGVPKEKAEKHDDKAFELGDDFYDQLEEMGFEKIADAELQLTNKKTIH
Ga0209306_10141848F072845N/AMSGEKLTINEDGLVTSIEVTDKDYDFGGGYTYHPSPYVLPVSEDIATTNIFSMSHDIDGKMRITGEDADIEINGISLKDTLHNLQERMAILQPNPTLEAEFKELRDIRQKYIELERTLLEKKQMWETLNKDD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.