NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209653_1037593

Scaffold Ga0209653_1037593


Overview

Basic Information
Taxon OID3300025695 Open in IMG/M
Scaffold IDGa0209653_1037593 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1980
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000375Metagenome / Metatranscriptome1217Y
F062168Metagenome / Metatranscriptome131N
F065691Metagenome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0209653_10375933F000375GGAGGMSKMYELEPMIMDCWHVCDDLKVVFKQIGDGERDPTPDELMNALMGVEQLYQWKFEQLFNKYEDVLRDKE
Ga0209653_10375935F062168AGGAMNMTSKGDLKDFLKEMGLESVHPKPSANKPDYMQPGYYVDPRNANGEVPF
Ga0209653_10375936F065691GAGGLNIYIPEPDIILLVLLSFLAGFLYRKYYDNETISDAFEEGFEKGAHSVVAAVSQLIGKDISIDFGKEQDDEYDK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.