NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209532_1007036

Scaffold Ga0209532_1007036


Overview

Basic Information
Taxon OID3300025696 Open in IMG/M
Scaffold IDGa0209532_1007036 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6498
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002322Metagenome / Metatranscriptome571Y
F022159Metagenome / Metatranscriptome215N

Sequences

Protein IDFamilyRBSSequence
Ga0209532_10070361F022159GGAGMTLDTRMVSMVLAENANEFITVKFLTKDNEERTYNGRLNVKKYLVGGERGRKAADVLKAHNLIPMFVGKDGEKPKYKSFCLDRVLAMKAGG
Ga0209532_100703612F002322GGAGMIPALPYSKLVEKHILECIQGGIGIRQMISSMQHLQDAPKSLSTMYKIYGSFIEMERAKINGAVGKRVIDQALDGDFKSQELFLRSKGGWSPTQTNIEVEQETDPDLDESAVDTLMSLLGYNTNGPEEESTCSCEEDNCRCS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.