NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209532_1033303

Scaffold Ga0209532_1033303


Overview

Basic Information
Taxon OID3300025696 Open in IMG/M
Scaffold IDGa0209532_1033303 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2261
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium GWB1_59_5(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009463Metagenome / Metatranscriptome317Y
F013249Metagenome / Metatranscriptome273Y

Sequences

Protein IDFamilyRBSSequence
Ga0209532_10333032F009463N/AMEKVKLTDILEEDYTKDVNITNDTSMYDPLFEDGDDQQGMLKYTTTIDGRRYKVSFDVNKNPTKKGIKVKFFPLDDSGIEIPNPSPEQLAQLQNDVATKLAPKFNDFRLEFDEDEDAPEKNVAAFQVPLSSFVSFVANVVFKK
Ga0209532_10333033F013249N/AMGKRKLLNLKVIGHSPKLLNEFINDNKFNIFKETFSGIKHAIRQNKDTAEICSVNTDVAIASIAKQDWENALSSSLGYFESNDEYEMCGDINYTLKMLRNARSTKQSKTISGSAVTS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.