NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209507_1003838

Scaffold Ga0209507_1003838


Overview

Basic Information
Taxon OID3300025706 Open in IMG/M
Scaffold IDGa0209507_1003838 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9069
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (93.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)40.3Long. (o)-88.15Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069433Metagenome / Metatranscriptome124N
F072819Metagenome121N

Sequences

Protein IDFamilyRBSSequence
Ga0209507_10038385F069433AGGAGMAHKMPPKQCSSNTPAWTDPVLTDLSMKVRKVHIDELRSFLNTEFVRRGLTQASFTDPTITALVTEIRKVHVDQLRTELAACKSGRGESGYCPQDSSGCMDFTDPTITALSTEVRGIHFRQMIQKVQALMTGCICETEQCQYCADCGYHYTTCSHAGVACDDHKYSECHHSINHYWNCASINLPSAAEHPYKSANPPVAWDGYVPWDWCVYTPPGSNWGTCEYQGGHNHSAWNCKCNPYS
Ga0209507_10038386F072819GAGMFQDQIKAQEVSFKIARLEGENAVSELVNWCRNNLDELTVQCFTHKRFMSVQALIDALCEVYRELGVEGDKGNISAFVLFLAGKHRDKIYASHVVVLNDMHRTIFKDKLGLDIEEIEPGLSKLDWRTDAGI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.