NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208741_10010802

Scaffold Ga0208741_10010802


Overview

Basic Information
Taxon OID3300025723 Open in IMG/M
Scaffold IDGa0208741_10010802 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2455
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043797Metagenome155Y
F048758Metagenome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0208741_100108022F048758GGAGMLPVYQDVVRKPNIMRTRNPLKQTTAKVVSLEDRLQELNTYKDWQKLISEYRNKGIILNPQLRPLVKMVKLGKILIDEDIQRALDVKHCTKKIAALEYFDPRLLQVVYCVKTPGKEEYHAVDGQHTATTLAALIDAELFDGESKWQDVKVAVLYIETTSKAFARKAFALINGRGKKKISAWYDHRTRVLSARIDDSQDDDDQEALRKQEICEKYDCYPVDTDSVFVGKPGTFTHMQAVNLDDDTLELACKFHNEYFHYDPIDGSLWFMMADIARAFNAAKIAITDEFLKELAGILQGYFAGLYEFHQSVKSAHLRWGKHTYGYEVAWNDDAIAAVLVLLYKKLGGKQKIPQPLLDRFEKILDFVDDDIKELYQEAA
Ga0208741_100108023F043797GGAGMTEDRLMVAEAVMAGQIPESHLTQDEIDELFEIACDAATEKLMAEAEQRGCSVFYGVEGGDTVH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.