NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208899_1007133

Scaffold Ga0208899_1007133


Overview

Basic Information
Taxon OID3300025759 Open in IMG/M
Scaffold IDGa0208899_1007133 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6595
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (88.89%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.12Long. (o)-75.25Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001655Metagenome / Metatranscriptome656Y
F002858Metagenome / Metatranscriptome525Y
F024320Metagenome / Metatranscriptome206Y
F030067Metagenome / Metatranscriptome186N

Sequences

Protein IDFamilyRBSSequence
Ga0208899_100713311F030067GGAGMPRESWEIAHDDYYDDLEAEDYKGLDDISAWKEEEQKIIDELCKRMEKAYSD
Ga0208899_100713313F024320AGGAMTIDEYATDSGILDDNSGPTVDPETHAMVEHLVEFDTEMYRLQSRRKYKGLSYRHLERLMIELHGEYWRDAL
Ga0208899_100713315F002858AGGAGMAIDEKSIYLVDGGDYQIYCLGYTQARTVTNDIMKRDPWGGIPFVYLQDQLEVSFDDRGNVVMPRVTLDRILFIASDELPQAESEL
Ga0208899_100713316F001655GGAGMKQPDNDHVKHFGNDGSIHNDAEIIVYYEQHGPAEPVLRIPFWYCKDELGLFENFEASVRRTAKALAESYTYWPEGYVHVQTVINQEYVNIV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.