NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208427_1008463

Scaffold Ga0208427_1008463


Overview

Basic Information
Taxon OID3300025771 Open in IMG/M
Scaffold IDGa0208427_1008463 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4098
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Associated Families5

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002502Metagenome / Metatranscriptome553Y
F029774Metagenome / Metatranscriptome187Y
F062573Metagenome / Metatranscriptome130Y
F076122Metagenome / Metatranscriptome118Y
F099390Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0208427_10084631F076122AGTAGGMEKHEVVNKILDYLDTRRTELSNEMASVAYQSTDYDALDAMYEVYDHLIAKL
Ga0208427_10084634F062573AGGTGGMARKQLKEFEVLEVRGFIVHAFDEKHALDKFGRYDYVSEGDVWPEVRELGPVNMSGTGPQ
Ga0208427_10084637F029774GAGMARSISVKVPTSLLVQQIEERIAQIDADIEEYPAKREAFEKAEEAYKSEVANFVSAYLGENLDKIGYGYEDIIRINTGYLGFRSSGGKVELTFDTDAIVGFPVRPEAPEKPNQRESFGRDYSTRKELLEKNLRILKMTSQEEVNASTYGAIMEIL
Ga0208427_10084638F002502AGGAMNTPTIGEAYTTAQSGVTGVVQEIVKNASGSFRVRLDVNGQERWTTVK
Ga0208427_10084639F099390N/AMKDGTYIVRLDDEGIPMLANQINMSDGYWVSDDSGVSVHGELEPNAVLDALSLMDIKDGEIVGVWQNKELSYIDRSYHFRNKDTALTVGEAFKQIAIWDCANSKALDIRYS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.