NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208325_1002884

Scaffold Ga0208325_1002884


Overview

Basic Information
Taxon OID3300025824 Open in IMG/M
Scaffold IDGa0208325_1002884 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4352
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)50.0621Long. (o)-124.7214Alt. (m)Depth (m)330
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076867Metagenome117N

Sequences

Protein IDFamilyRBSSequence
Ga0208325_10028842F076867GAGMDERNRNLTEIAKKKRYIALVEKLSRSTLTQKEVKELEGFEKANSRPEVDVIAGTVDLPTMSIFLEKSPRMVRRYIDQGMPVIRDSAGEIFRFKVNDVFKWLYGSKAGDDEGKEYWDNEYRKNRAKLSKIELRQKEGEIISFEDHVSIVKNQVRGVKTGFLRLPKHVAPKLYQQEPKVICEILDEEIRFIINQFAGMRHVNKARKRNT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.