 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300025853 Open in IMG/M |
| Scaffold ID | Ga0208645_1024072 Open in IMG/M |
| Source Dataset Name | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3278 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (90.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Delaware Bay | |||||||
| Coordinates | Lat. (o) | 39.12 | Long. (o) | -75.25 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002318 | Metagenome / Metatranscriptome | 571 | Y |
| F008795 | Metagenome | 328 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208645_10240721 | F008795 | AGGA | MIKVKLEANEVELALNIASKRYIGNLRMGKTFSYGYTKGIKSQLTDGILGALGEVAYAKATNSFYNGSYSDNNQFYSDSDFQNNIEIRTQENKSYNFLLIRPGEKKGTYILIIKDNNEDFKFTIMGSFIYNDDL |
| Ga0208645_10240726 | F002318 | AGGGGG | LKAKDFKSITNILESKNKDKQFFTFMDFEDTEIRKKEVILPLPKQYFNNIVKLIKGGKXAKKKKYIILI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |