NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208645_1046882

Scaffold Ga0208645_1046882


Overview

Basic Information
Taxon OID3300025853 Open in IMG/M
Scaffold IDGa0208645_1046882 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2089
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.12Long. (o)-75.25Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015587Metagenome253Y
F055679Metagenome / Metatranscriptome138Y
F056536Metagenome137N

Sequences

Protein IDFamilyRBSSequence
Ga0208645_10468822F055679GGAGMIDLTSGWVPHPGVTGGFHLVYIDSLVGEISIVTGPKGSGLMAANDPGSETTYEAWFPGMCDPTGYLTLAEVQGIIKFMRQREQERLAWQDED
Ga0208645_10468826F056536N/AMLCYYPYEGATERITWHGGESTMLHYQVQVDDYKGDPDWIERYSQTIMGGIPCGTKELLTAMSDYYQYISTMHLDTMAGTIF
Ga0208645_10468827F015587N/AMTKLNIRKNIATALVNTAAAIENAKMPTKADVGFKLHDIRCRAAALMMPNDMAFIITPNKSK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.