NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209099_1000541

Scaffold Ga0209099_1000541


Overview

Basic Information
Taxon OID3300025858 Open in IMG/M
Scaffold IDGa0209099_1000541 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)44396
Total Scaffold Genes75 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)45 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan
CoordinatesLat. (o)35.92Long. (o)139.63Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058120Metagenome / Metatranscriptome135Y
F089950Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0209099_100054119F058120GAGGMTMTTTATASEFGKTLLETIKSKDVLNTITQVQQYKENMRDVTVGADYVTWISEPVNLTLVHKALAEDLGVPPRVLAIRRAQMSRPQRAYLLVQAMELGIKKVHKL
Ga0209099_100054155F089950N/AMASYFREGSNFSFNGIKGTIVKITETYRKNVLVIKVSELPKNNQFKGRKVETIGIFEYPDGTLEFMAVID

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.