NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209099_1031515

Scaffold Ga0209099_1031515


Overview

Basic Information
Taxon OID3300025858 Open in IMG/M
Scaffold IDGa0209099_1031515 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2814
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nomurabacteria → Candidatus Nomurabacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan
CoordinatesLat. (o)35.92Long. (o)139.63Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017088Metagenome242Y
F029010Metagenome / Metatranscriptome189Y

Sequences

Protein IDFamilyRBSSequence
Ga0209099_10315152F017088AGGMSTHYQGDPRQITAKFPSTCHTCGKKINKGEHIIYWPNGKKAGHLKCDEDDYRHSLASFEDEDRYNGKY
Ga0209099_10315154F029010AGGAGMERILKVENLQLVIEKRGKLVQTRSELERFQMASNDFNCSMRLNDSDGNVFTTSFTPGIKKVIEFLKSSFDASIAETEEKITF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.