NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210051_1148899

Scaffold Ga0210051_1148899


Overview

Basic Information
Taxon OID3300025868 Open in IMG/M
Scaffold IDGa0210051_1148899 Open in IMG/M
Source Dataset NameGroundwater microbial communities from aquifer - Crystal Geyser CG23_combo_of_CG06-09_8/20/14_all (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1161
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → environmental samples → uncultured archaeal virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location
Location NameUSA: Utah: Grand County
CoordinatesLat. (o)38.9383Long. (o)-110.1342Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014357Metagenome / Metatranscriptome263Y
F019951Metagenome / Metatranscriptome226N
F026802Metagenome / Metatranscriptome196N

Sequences

Protein IDFamilyRBSSequence
Ga0210051_11488991F026802N/AMYYYVPFSRDLTQGNTEEIAVADPGHLVGVFLRFKSGSGGFHPLWGQISISNIGTTKEYLLKNGIYAIFQRDTDVFALNHWFQPAFIPLDHDIRANHEVLLETMTWGANFISV
Ga0210051_11488992F019951N/AMTILFKEFRIDVSANNVKCEANNKLYVQKGQKIILHAIQIAPGASTADEDVFIMLYRDQEQLAGEGIYHAVIDDYTHTIEFDADAVEGQTFVTKAWGLNARTIQGVYMYEITS
Ga0210051_11488993F014357N/ATDTQITKKNNPSEFCDFPFRGGVATKRKIDLYGVLYSSRGADDNNNVTHSIHTKYLKLMKGRDVLFDSMRNGLIAIGSDVLSVGTFEAENGYDLGGENSDQYQKDGLIFDQPIRFANGEELDTYWTTEVAATPGTFLASELEIAYILKETQE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.