Scaffold Ga0210051_1388885

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0210051_1388885

Scaffold Ga0210051_1388885

Overview

Basic Information
Taxon OID	3300025868 Open in IMG/M
Scaffold ID	Ga0210051_1388885 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from aquifer - Crystal Geyser CG23_combo_of_CG06-09_8/20/14_all (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	531
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location
Location Name	USA: Utah: Grand County
Coordinates	Lat. (^o)	38.9383	Long. (^o)	-110.1342	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026802	Metagenome / Metatranscriptome	196	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0210051_13888851	F026802	N/A	MYYYVPFSRNLTLGNTEEIAAADPGHLVGVFLRFKSGVEGFHPLWGQISISNIGTTKEYLLKNGIYAIFQRGTDVYVYNDWCQPAFIPLDHDIRANHQVLLETFTWGANFISVRGHFIYS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.