Scaffold Ga0209757_10281541

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209757_10281541

Scaffold Ga0209757_10281541

Overview

Basic Information
Taxon OID	3300025873 Open in IMG/M
Scaffold ID	Ga0209757_10281541 Open in IMG/M
Source Dataset Name	Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	529
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	18.92	Long. (^o)	-104.89	Alt. (m)		Depth (m)	1000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073658	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209757_102815412	F073658	AGGA	MGSIVGKAIKGFGKALRAHRIKHGKRGKTITGVKPMSGKTPWWVTAGGKNPEKRAAIVKTHFSNVRSDKISKAHKQVKEGKKKLKDLIESGQAEEIGEGGKYGYKKKGFN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.