NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209534_10003624

Scaffold Ga0209534_10003624


Overview

Basic Information
Taxon OID3300025880 Open in IMG/M
Scaffold IDGa0209534_10003624 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14642
Total Scaffold Genes36 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (80.56%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011743Metagenome / Metatranscriptome287Y
F012887Metagenome / Metatranscriptome276N
F054001Metagenome / Metatranscriptome140N

Sequences

Protein IDFamilyRBSSequence
Ga0209534_1000362415F054001AGGGGGMIPDWILSLQSSATWARRYENRASFEWDQDVVKELQIIAERLETLLSDQEEKYEVCIKYIKRLERKSAEQ
Ga0209534_1000362428F011743AGGAGMNRLTKICIAVAVVAAVLWISSMDYSHEVSISKEYQYNVCNGYWPDFKNLNPDCKEYR
Ga0209534_100036248F012887GAGMETWEVIVQSWPVAAGVFLLILTIGKILNRLDVLESKMVEVWKAINELVRK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.