NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209456_10000335

Scaffold Ga0209456_10000335


Overview

Basic Information
Taxon OID3300025883 Open in IMG/M
Scaffold IDGa0209456_10000335 Open in IMG/M
Source Dataset NamePelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25766
Total Scaffold Genes37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (64.86%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, North Sea, Atlantic Ocean
CoordinatesLat. (o)53.9944Long. (o)6.8905Alt. (m)Depth (m)29
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070128Metagenome / Metatranscriptome123Y
F082711Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0209456_1000033511F070128N/AMWAGVIFLLVGGFGSLSAGSITATSIMALSLASALLLLDLSGKPKPRSAKSFIGFGFLAVAVGAAFVMLYEILSR
Ga0209456_1000033530F082711GGAMDSAEALQVIRGLARVNRIRLTAHAEREAAECGATRGLIMRMIELKRKLDGRTFRGRVPCSVSKKRPELGPLIHIDDLGVFEGKVVQSIFSQKLLGPQSFRFCRSSCEMSMQAVADLLQVDRRTVQRWESEESPVPPWAMLLVAKMADERSKGRAVMRKWLTELADEEGRPTEIDLDVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.