NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209631_10004104

Scaffold Ga0209631_10004104


Overview

Basic Information
Taxon OID3300025890 Open in IMG/M
Scaffold IDGa0209631_10004104 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16288
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (13.16%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027054Metagenome / Metatranscriptome196N
F032856Metagenome / Metatranscriptome179N
F034391Metagenome / Metatranscriptome175N

Sequences

Protein IDFamilyRBSSequence
Ga0209631_1000410431F032856N/AMDEAKYRYWAKEYSDHLIEDVSDELVDEYETDNPTNEANANDEFVVEEDYVMQLIEYWIDNYTMGNHKCKEIVDNLDYDIFEIDMEFGTRPDSWKQAGVWALDHAIHTNDNVEAIYKMTNEKLQELWKK
Ga0209631_1000410432F034391N/AMRNYSQQYDNKLLEGILDYMANELKGEFGFETLDAEDKLDVIALFVDNPTSWETPYLHSIETTDTEVISSRKKSNVEILQDLSNYTRYDG
Ga0209631_1000410435F027054N/AMTKQKKETSRHWTVELNIGSKRNMGKLRHSKSSGYRYDYHDLNHVRKKVENRFDGGSGNIIKAMFEFDGTYNDEIEKSFYIAFSFYGNIETFKEDDGLEGEYMAYEDLKKLEDKLTILCMELEQECIGYNIKEWTSSTFYPTGKQDLIYHPNYDGEQMIFEDEYFMTFGYHKLSSFEKLHTV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.