NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209630_10121480

Scaffold Ga0209630_10121480


Overview

Basic Information
Taxon OID3300025892 Open in IMG/M
Scaffold IDGa0209630_10121480 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1369
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006221Metagenome / Metatranscriptome378Y
F031509Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0209630_101214802F031509GGAGMGNNKVNYIVKVMWPPHCRNRSAEVLEDRADIVKEMNGMRSKIENFLKASCSGSYKVSNEYDMQGFNIGLEQGPDVYNLILEQATIGYEVDREIGRYNIFSDKYIKHKILYTAKGIVVD
Ga0209630_101214803F006221N/ALGSNKSKMPLADLHKYGPIISVSNHKHDAKYIDYVWTRDENDLLWFLQQRPSPVDCVTTPELYKKYVFYDQVHSFPPISPQFNLTLDVNTDDQILALLAALGLCDKRILLIGYDIVHPKVLKDLRSVIMLHPEMKFYFLCNPPKTKQLDYCSNAECVLFKDMETLKNG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.